HORDB

ID: hor006088
Uniprot ID: O61704
Protein name: Plasmatocyte-spreading peptide
Gene name: PSP1
Organism: Chrysodeixis includens (Soybean looper) (Pseudoplusia includens)
Family: GBP/PSP1/paralytic peptide family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Chrysodeixis (genus), Plusiinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005125 cytokine activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005615 extracellular space

Sequence: ENFNGGCLAGYMRTADGRCKPTF
Length: 23(119-141)
Propeptide: MKLTINILFCLILISQYNSANGNLRDLFNNVRGSISSSANKIRQDVKTLFHPSDKSGNKESSNIVFVEDKDEGAVGPARDNKPVAVTPAPVVSTTTQASAPTVATNGTATGGKDDKGRENFNGGCLAGYMRTADGRCKPTF
Signal peptide: MKLTINILFCLILISQYNSANG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Mediates the spreading of plasmatocytes to foreign surfaces. Plasmocytes are a class of hemocytes involved in insect cellular immunity.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

1b1v.pdb

hor006088_AF2.pdb

hor006088_ESM.pdb

Mass:	290142	Formula:	C106H162N32O33S3
Absent amino acids:	HIQSVW	Common amino acids:	G
pI:	8.22	Basic residues:	3
Polar residues:	11	Hydrophobic residues:	5
Hydrophobicity:	-56.09	Boman Index:	-4631
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	25.65
Instability Index:	2076.52	Extinction Coefficient cystines:	1615
Absorbance 280nm:	73.41

PubMed ID: 9753657
Title: Plasmatocyte spreading peptide is encoded by an mRNA differentially expressed in tissues of the moth Pseudoplusia includens.
PubMed ID: 9287360
Title: Isolation and identification of a plasmatocyte-spreading peptide from the hemolymph of the lepidopteran insect Pseudoplusia inclu
PubMed ID: 9988679
Title: