General Information

  • ID:  hor006088
  • Uniprot ID:  O61704(119-141)
  • Protein name:  Plasmatocyte-spreading peptide
  • Gene name:  PSP1
  • Organism:  Chrysodeixis includens (Soybean looper) (Pseudoplusia includens)
  • Family:  GBP/PSP1/paralytic peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Chrysodeixis (genus), Plusiinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005125 cytokine activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005615 extracellular space

Sequence Information

  • Sequence:  ENFNGGCLAGYMRTADGRCKPTF
  • Length:  23(119-141)
  • Propeptide:  MKLTINILFCLILISQYNSANGNLRDLFNNVRGSISSSANKIRQDVKTLFHPSDKSGNKESSNIVFVEDKDEGAVGPARDNKPVAVTPAPVVSTTTQASAPTVATNGTATGGKDDKGRENFNGGCLAGYMRTADGRCKPTF
  • Signal peptide:  MKLTINILFCLILISQYNSANG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Mediates the spreading of plasmatocytes to foreign surfaces. Plasmocytes are a class of hemocytes involved in insect cellular immunity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45857
  • Structure ID:  AF-O61704-F1(AlphaFold_DB_ID)/1B1V(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1b1v.pdbhor006088_AF2.pdbhor006088_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 290142 Formula: C106H162N32O33S3
Absent amino acids: HIQSVW Common amino acids: G
pI: 8.22 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 5
Hydrophobicity: -56.09 Boman Index: -4631
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 25.65
Instability Index: 2076.52 Extinction Coefficient cystines: 1615
Absorbance 280nm: 73.41

Literature

  • PubMed ID:  9753657
  • Title:  Plasmatocyte spreading peptide is encoded by an mRNA differentially expressed in tissues of the moth Pseudoplusia includens.
  • PubMed ID:  9287360
  • Title:  Isolation and identification of a plasmatocyte-spreading peptide from the hemolymph of the lepidopteran insect Pseudoplusia inclu
  • PubMed ID:  9988679
  • Title: